PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G054500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 1040aa    MW: 118549 Da    PI: 9.1909
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G054500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.72.4e-12494538348
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         W +e+d +l  av+ +G ++W ++a+++  gRt+ qc +rw k l
  Aqcoe3G054500.1.p 494 DWLEEDDAQLRSAVEAFGENNWQLVASYVE-GRTGTQCSNRWMKTL 538
                        79****************************.***********9975 PP

2Myb_DNA-binding49.31.1e-15546591248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        grWT eEd+ l+ av ++G++tW++I++ ++ gRt  qc++rw ++l
  Aqcoe3G054500.1.p 546 GRWTIEEDKHLKVAVVLFGSKTWNKISQFVP-GRTQAQCRERWVNVL 591
                        8******************************.***********9975 PP

3Myb_DNA-binding476.1e-15599641347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rWT++Ed +l+ a++++G   W+++a+ ++  Rt++qc+ rw  +
  Aqcoe3G054500.1.p 599 RWTADEDFKLKAAIAEHGHC-WRKVAEAVP-PRTDNQCRRRWKVL 641
                        8*****************99.*********.9**********865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.5338435IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-8342357IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-8406446IPR009057Homeodomain-like
PROSITE profilePS500905.215408433IPR017877Myb-like domain
SuperFamilySSF466898.79E-15418483IPR009057Homeodomain-like
PROSITE profilePS500908.699434486IPR017877Myb-like domain
SMARTSM007170.0028438488IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-9447492IPR009057Homeodomain-like
SuperFamilySSF466895.53E-18471541IPR009057Homeodomain-like
PROSITE profilePS5129420.888487542IPR017930Myb domain
SMARTSM007174.6E-13491540IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-15493541IPR009057Homeodomain-like
PfamPF002492.8E-11493537IPR001005SANT/Myb domain
CDDcd001673.61E-10495538No hitNo description
PROSITE profilePS5009010.371540591IPR017877Myb-like domain
SMARTSM007175.2E-11544593IPR001005SANT/Myb domain
SuperFamilySSF466897.7E-26544638IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-18546596IPR009057Homeodomain-like
PfamPF002493.1E-14546591IPR001005SANT/Myb domain
CDDcd001672.32E-9547591No hitNo description
PROSITE profilePS5129422.242592646IPR017930Myb domain
SMARTSM007174.1E-13596644IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-17597640IPR009057Homeodomain-like
CDDcd001671.62E-11599642No hitNo description
PfamPF002491.9E-13599640IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1040 aa     Download sequence    Send to blast
MAIPPPPPNR KPASKFNSEE EEFESDEEDD QKDSLWNQDM EAVRRACMLT GTNPNEIEED  60
FNTTISISDS ESSEVDDIEL VRRIQQSINS NSNKPVSLKP LKSLPPVGLS DISSDDDDDE  120
DDDDLQTLRA IQRRFANYVP NAVQTNTTTI SNESEVVQGT DRTLQQENSR SSSINRKDPN  180
ILGEGFPISE EACNISLPMV SIKDTDAELP ALSSKFSGFP HPKSAQIFLD AIKKNRSFQK  240
LVMRNLIHIE AKIEENKKLK ERIKILRDFQ VSCKRRAGRA LSQKKDPRIQ LISACKPRKS  300
SVSKVNDKKV PALYLGPVEN SHVDNYRMVM QRFPRSLRRE CWSDVERENL GKGIKQQFQE  360
MLLQKSLERY SDQMVSSGDS NTFDDIMTSI RDFDIPPESI RTFLPKVDWE RLASLYAVGR  420
SGAECEARWL NHEDPLINHN PWTKVEDKNL LFIVRQRGIY NWIDISKRMK TSRTPFQCFV  480
RYQRSLNAHI MKRDWLEEDD AQLRSAVEAF GENNWQLVAS YVEGRTGTQC SNRWMKTLNP  540
ARERVGRWTI EEDKHLKVAV VLFGSKTWNK ISQFVPGRTQ AQCRERWVNV LDPSLNLARW  600
TADEDFKLKA AIAEHGHCWR KVAEAVPPRT DNQCRRRWKV LFPHEVPILQ AARRVEKIAL  660
ISNFVEREAE RPELGSSDFL PLPGPNDITE DGNNIRKGKE KSRRTARSMK QKDMSPGNDD  720
FSKKKKVRKQ RLKSSRCPEP PLSSEEILPS DQILSKENVG DGDEKTVPKE NVAGKKKKGL  780
KPCSKEKCTK SKHCGQELPL SIETSGGLKN ESITEDNTTS KKKRKGRPCS DNKKCKEREP  840
CDHQEPPLSP QLSAILEIIG GEHEILTEDN TTLQNDKRKV RAKRNKYSQQ EESNKSKVAG  900
ISQSKKSLEI MDEDDELEDN ESLASFLHNK MNKVKRKAHI SADKNGLVII PPARKRKVTT  960
EIPSVSETSM LLAETVDGDD EILTSLMKNK VKRRRLKPAG KEKIPKAMNW DDTTLAFFLN  1020
KKLKRRSNCS SVDGQAIAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-284086382155MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-284086382155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1934956KRKAHISADKNGLVIIPPARKRK
2991995KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243797.10.0PREDICTED: uncharacterized protein LOC104587774 isoform X1
TrEMBLW9RFI80.0W9RFI8_9R
STRINGPOPTR_0015s04260.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-173myb domain protein 4r1